Anti ATN1 pAb (ATL-HPA031619 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA031619-25

Protein Description: atrophin 1
Gene Name: ATN1
Alternative Gene Name: B37, D12S755E, DRPLA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000107478: 90%, ENSRNOG00000060594: 90%
Entrez Gene ID: 1822
Uniprot ID: P54259
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HPYAMSPSLGSLRPYPPGPAHLPPPHSQVSYSQAGPNGPPVSSSSNSSSSTSQGSYPCSHPSPSQGPQGAPYPFPPVPTVTTSSATLSTVIATVASSPAGYKTASPPGPPPYGKRAPSPGAYKTATPPGYKPGSPPSFRTGTPPGY
• Gene Sequence: HPYAMSPSLGSLRPYPPGPAHLPPPHSQVSYSQAGPNGPPVSSSSNSSSSTSQGSYPCSHPSPSQGPQGAPYPFPPVPTVTTSSATLSTVIATVASSPAGYKTASPPGPPPYGKRAPSPGAYKTATPPGYKPGSPPSFRTGTPPGY
• Gene ID - Mouse: ENSMUSG00000107478
• Gene ID - Rat: ENSRNOG00000060594
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ATN1 pAb (ATL-HPA031619 w/enhanced validation) – 2 Found

Zhang, Feng; Xu, Dan; Yuan, Ling; Sun, Yiming; Xu, Zhiheng. Epigenetic regulation of Atrophin1 by lysine-specific demethylase 1 is required for cortical progenitor maintenance. Nature Communications. 2014;5( 25519973):5815. 

Zhang, Yi; Wu, Ziyi; Li, Xingyue; Wan, Yuxiao; Zhang, Yinong; Zhao, Ping. Maternal sevoflurane exposure affects differentiation of hippocampal neural stem cells by regulating miR-410-3p and ATN1. Stem Cell Research & Therapy. 2020;11(1):423.