Anti ATG5 pAb (ATL-HPA042973 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA042973-25

Protein Description: autophagy related 5
Gene Name: ATG5
Alternative Gene Name: APG5, APG5L, ASP, hAPG5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038160: 96%, ENSRNOG00000000322: 94%
Entrez Gene ID: 9474
Uniprot ID: Q9H1Y0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MSCMKEADALKHKSQVINEMQKKDHKQLWMGLQNDRFDQFWAINRKLMEYPAEENGFRYIPFRIYQTTTERPFIQKLFRPVAADGQLHTLGDLLKEVCPSAIDPEDGEKKNQVMIHGIEPMLETPLQWLSEHLSYPDNFL
• Gene Sequence: MSCMKEADALKHKSQVINEMQKKDHKQLWMGLQNDRFDQFWAINRKLMEYPAEENGFRYIPFRIYQTTTERPFIQKLFRPVAADGQLHTLGDLLKEVCPSAIDPEDGEKKNQVMIHGIEPMLETPLQWLSEHLSYPDNFL
• Gene ID - Mouse: ENSMUSG00000038160
• Gene ID - Rat: ENSRNOG00000000322
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ATG5 pAb (ATL-HPA042973 w/enhanced validation) – 1 Found

Garofalo, Tina; Matarrese, Paola; Manganelli, Valeria; Marconi, Matteo; Tinari, Antonella; Gambardella, Lucrezia; Faggioni, Alberto; Misasi, Roberta; Sorice, Maurizio; Malorni, Walter. Evidence for the involvement of lipid rafts localized at the ER-mitochondria associated membranes in autophagosome formation. Autophagy. 2016;12(6):917-35.