Anti ATF7IP2 pAb (ATL-HPA041156 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA041156-25

Protein Description: activating transcription factor 7 interacting protein 2
Gene Name: ATF7IP2
Alternative Gene Name: FLJ12668
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039200: 58%, ENSRNOG00000025522: 40%
Entrez Gene ID: 80063
Uniprot ID: Q5U623
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SVESPNLTTPITSNPTDTRKITSGNSSNSPNAEVMAVQKKLDSIIDLTKEGLSNCNTESPVSPLESHSKAASNSKETTPLAQNAVQVPESFEHLPPLPEPPAPL
• Gene Sequence: SVESPNLTTPITSNPTDTRKITSGNSSNSPNAEVMAVQKKLDSIIDLTKEGLSNCNTESPVSPLESHSKAASNSKETTPLAQNAVQVPESFEHLPPLPEPPAPL
• Gene ID - Mouse: ENSMUSG00000039200
• Gene ID - Rat: ENSRNOG00000025522
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.