Anti ASS1 pAb (ATL-HPA020896 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA020896-25

Protein Description: argininosuccinate synthase 1
Gene Name: ASS1
Alternative Gene Name: ASS, CTLN1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000076441: 97%, ENSRNOG00000008837: 97%
Entrez Gene ID: 445
Uniprot ID: P00966
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MSSKGSVVLAYSGGLDTSCILVWLKEQGYDVIAYLANIGQKEDFEEARKKALKLGAKKVFIEDVSREFVEEFIWPAIQS
• Gene Sequence: MSSKGSVVLAYSGGLDTSCILVWLKEQGYDVIAYLANIGQKEDFEEARKKALKLGAKKVFIEDVSREFVEEFIWPAIQS
• Gene ID - Mouse: ENSMUSG00000076441
• Gene ID - Rat: ENSRNOG00000008837
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ASS1 pAb (ATL-HPA020896 w/enhanced validation) – 4 Found

Ohshima, Kenji; Nojima, Satoshi; Tahara, Shinichiro; Kurashige, Masako; Hori, Yumiko; Hagiwara, Kohei; Okuzaki, Daisuke; Oki, Shinya; Wada, Naoki; Ikeda, Jun-Ichiro; Kanai, Yoshikatsu; Morii, Eiichi. Argininosuccinate Synthase 1-Deficiency Enhances the Cell Sensitivity to Arginine through Decreased DEPTOR Expression in Endometrial Cancer. Scientific Reports. 2017;7( 28358054):45504. 

Slebos, Robbert J C; Jehmlich, Nico; Brown, Brandee; Yin, Zhirong; Chung, Christine H; Yarbrough, Wendell G; Liebler, Daniel C. Proteomic analysis of oropharyngeal carcinomas reveals novel HPV-associated biological pathways. International Journal Of Cancer. 2013;132(3):568-79. 

Edfors, Fredrik; Danielsson, Frida; Hallström, Björn M; Käll, Lukas; Lundberg, Emma; Pontén, Fredrik; Forsström, Björn; Uhlén, Mathias. Gene-specific correlation of RNA and protein levels in human cells and tissues. Molecular Systems Biology. 2016;12(10):883. 

Werner, Anke; Pieh, Daniel; Echchannaoui, Hakim; Rupp, Johanna; Rajalingam, Krishnaraj; Theobald, Matthias; Closs, Ellen I; Munder, Markus. Cationic Amino Acid Transporter-1-Mediated Arginine Uptake Is Essential for Chronic Lymphocytic Leukemia Cell Proliferation and Viability. Frontiers In Oncology. 9( 31824848):1268.