Anti ASPH pAb (ATL-HPA059303)

Atlas Antibodies

Catalog No.: ATL-HPA059303-25

Protein Description: aspartate beta-hydroxylase
Gene Name: ASPH
Alternative Gene Name: BAH, CASQ2BP1, HAAH, JCTN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028207: 70%, ENSRNOG00000007445: 73%
Entrez Gene ID: 444
Uniprot ID: Q12797
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DYEEVLGKLGIYDADGDGDFDVDDAKVLLGLKERSTSEPAVPPEEAEPHTEPEEQVPVEAEPQNIEDEAKEQIQSLLHEMVHAEHVEGEDLQQEDGPT
• Gene Sequence: DYEEVLGKLGIYDADGDGDFDVDDAKVLLGLKERSTSEPAVPPEEAEPHTEPEEQVPVEAEPQNIEDEAKEQIQSLLHEMVHAEHVEGEDLQQEDGPT
• Gene ID - Mouse: ENSMUSG00000028207
• Gene ID - Rat: ENSRNOG00000007445
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.