Anti ASCL3 pAb (ATL-HPA027032)

Atlas Antibodies

Catalog No.: ATL-HPA027032-25

Protein Description: achaete-scute family bHLH transcription factor 3
Gene Name: ASCL3
Alternative Gene Name: bHLHa42, HASH3, Sgn1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035951: 60%, ENSRNOG00000013451: 29%
Entrez Gene ID: 56676
Uniprot ID: Q9NQ33
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NSSLPDKLPIFPDSARLPLTRSFYLEPMVTFHVHPEAPVSSPYSEELPRLPFPSDSLILGNYSEPCPFSFPMPYPNYRGCEYSYGP
• Gene Sequence: NSSLPDKLPIFPDSARLPLTRSFYLEPMVTFHVHPEAPVSSPYSEELPRLPFPSDSLILGNYSEPCPFSFPMPYPNYRGCEYSYGP
• Gene ID - Mouse: ENSMUSG00000035951
• Gene ID - Rat: ENSRNOG00000013451
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.