Anti ASAP3 pAb (ATL-HPA020537)

Atlas Antibodies

Catalog No.: ATL-HPA020537-25

Protein Description: ArfGAP with SH3 domain, ankyrin repeat and PH domain 3
Gene Name: ASAP3
Alternative Gene Name: CENTB6, DDEFL1, FLJ20199, UPLC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036995: 79%, ENSRNOG00000049714: 82%
Entrez Gene ID: 55616
Uniprot ID: Q8TDY4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EAQLPSHGGPKPSAESDMGTRRDYIMAKYVEHRFARRCTPEPQRLWTAICNRDLLSVLEAFA
• Gene Sequence: EAQLPSHGGPKPSAESDMGTRRDYIMAKYVEHRFARRCTPEPQRLWTAICNRDLLSVLEAFA
• Gene ID - Mouse: ENSMUSG00000036995
• Gene ID - Rat: ENSRNOG00000049714
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.