Anti ARPIN pAb (ATL-HPA052278)

Atlas Antibodies

SKU: ATL-HPA052278-25

• 

Protein Description: actin-related protein 2/3 complex inhibitor
Gene Name: ARPIN
Alternative Gene Name: C15orf38, MGC61550
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039043: 89%, ENSRNOG00000014589: 89%
Entrez Gene ID: 348110
Uniprot ID: Q7Z6K5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EVMELELGAGVRLKTRGDGPFLDSLAKLEAGTVTKCNFTGDGKTGASWTDNIMAQKCSKGAAAEIREQGDGAEDEEWDD
• Gene Sequence: EVMELELGAGVRLKTRGDGPFLDSLAKLEAGTVTKCNFTGDGKTGASWTDNIMAQKCSKGAAAEIREQGDGAEDEEWDD
• Gene ID - Mouse: ENSMUSG00000039043
• Gene ID - Rat: ENSRNOG00000014589
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.