Anti ARNT2 pAb (ATL-HPA001056)

Atlas Antibodies

SKU: ATL-HPA001056-25

• 

Protein Description: aryl-hydrocarbon receptor nuclear translocator 2
Gene Name: ARNT2
Alternative Gene Name: bHLHe1, KIAA0307
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015709: 98%, ENSRNOG00000013017: 97%
Entrez Gene ID: 9915
Uniprot ID: Q9HBZ2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GKDILEFCHPEDQSHLRESFQQVVKLKGQVLSVMYRFRTKNREWMLIRTSSFTFQNPYSDEIEYIICTNTNVKQLQQQQAELEVHQRDGLSSYDLSQVPVPNLPAGVHEAGKSVEKADAIFS
• Gene Sequence: GKDILEFCHPEDQSHLRESFQQVVKLKGQVLSVMYRFRTKNREWMLIRTSSFTFQNPYSDEIEYIICTNTNVKQLQQQQAELEVHQRDGLSSYDLSQVPVPNLPAGVHEAGKSVEKADAIFS
• Gene ID - Mouse: ENSMUSG00000015709
• Gene ID - Rat: ENSRNOG00000013017
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ARNT2 pAb (ATL-HPA001056) – 1 Found

Ek, Sara; Andréasson, Ulrika; Hober, Sophia; Kampf, Caroline; Pontén, Fredrik; Uhlén, Mathias; Merz, Hartmut; Borrebaeck, Carl A K. From gene expression analysis to tissue microarrays: a rational approach to identify therapeutic and diagnostic targets in lymphoid malignancies. Molecular & Cellular Proteomics : Mcp. 2006;5(6):1072-81.