Anti ARNT pAb (ATL-HPA001759 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA001759-25

Protein Description: aryl hydrocarbon receptor nuclear translocator
Gene Name: ARNT
Alternative Gene Name: bHLHe2, HIF-1beta
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015522: 82%, ENSRNOG00000031174: 83%
Entrez Gene ID: 405
Uniprot ID: P27540
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RFSCLRPRVAGTTEMTSDVPSLGPAIASGNSGPGIQGGGAIVQRAIKRRPGLDFDDDGEGNSKFLRCDDDQMSNDKERFARSDDEQSSADKERLARENHSEIERRRRNKMTAYITELSDMV
• Gene Sequence: RFSCLRPRVAGTTEMTSDVPSLGPAIASGNSGPGIQGGGAIVQRAIKRRPGLDFDDDGEGNSKFLRCDDDQMSNDKERFARSDDEQSSADKERLARENHSEIERRRRNKMTAYITELSDMV
• Gene ID - Mouse: ENSMUSG00000015522
• Gene ID - Rat: ENSRNOG00000031174
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ARNT pAb (ATL-HPA001759 w/enhanced validation) – 1 Found

McKay, Tina B; Hjortdal, Jesper; Priyadarsini, Shrestha; Karamichos, Dimitrios. Acute hypoxia influences collagen and matrix metalloproteinase expression by human keratoconus cells in vitro. Plos One. 12(4):e0176017.