Anti ARHGEF6 pAb (ATL-HPA003578)

Atlas Antibodies

SKU: ATL-HPA003578-100

• 
• 
• 

Protein Description: Rac/Cdc42 guanine nucleotide exchange factor (GEF) 6
Gene Name: ARHGEF6
Alternative Gene Name: alpha-PIX, alphaPIX, Cool-2, Cool2, KIAA0006, MRX46
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031133: 85%, ENSRNOG00000000869: 88%
Entrez Gene ID: 9459
Uniprot ID: Q15052
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VQYGACEEKEERYLMLFSNVLIMLSASPRMSGFIYQGKIPIAGTVVTRLDEIEGNDCTFEITGNTVERIVVHCNNNQDFQEWLEQLNRLIRGPASCSSLSKTSSSSCSAHS
• Gene Sequence: VQYGACEEKEERYLMLFSNVLIMLSASPRMSGFIYQGKIPIAGTVVTRLDEIEGNDCTFEITGNTVERIVVHCNNNQDFQEWLEQLNRLIRGPASCSSLSKTSSSSCSAHS
• Gene ID - Mouse: ENSMUSG00000031133
• Gene ID - Rat: ENSRNOG00000000869
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ARHGEF6 pAb (ATL-HPA003578) – 1 Found

Kortüm, Fanny; Harms, Frederike Leonie; Hennighausen, Natascha; Rosenberger, Georg. αPIX Is a Trafficking Regulator that Balances Recycling and Degradation of the Epidermal Growth Factor Receptor. Plos One. 10(7):e0132737.