Anti ARHGEF5 pAb (ATL-HPA029504)

Atlas Antibodies

Catalog No.: ATL-HPA029504-25

Protein Description: Rho guanine nucleotide exchange factor (GEF) 5
Gene Name: ARHGEF5
Alternative Gene Name: GEF5, P60, TIM, TIM1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033542: 94%, ENSRNOG00000005506: 95%
Entrez Gene ID: 7984
Uniprot ID: Q12774
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NLFRLFLRQNTQGAQAEFLFRTETQSEKLRWISALAMPREELDLLECYNSPQVQCLRAYKPRENDELALEKADVVMVTQQSSDGWLEGVRLSDG
• Gene Sequence: NLFRLFLRQNTQGAQAEFLFRTETQSEKLRWISALAMPREELDLLECYNSPQVQCLRAYKPRENDELALEKADVVMVTQQSSDGWLEGVRLSDG
• Gene ID - Mouse: ENSMUSG00000033542
• Gene ID - Rat: ENSRNOG00000005506
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.