Anti ARHGEF40 pAb (ATL-HPA030745)

Atlas Antibodies

Catalog No.: ATL-HPA030745-25

Protein Description: Rho guanine nucleotide exchange factor 40
Gene Name: ARHGEF40
Alternative Gene Name: FLJ10357, solo
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004562: 82%, ENSRNOG00000052354: 82%
Entrez Gene ID: 55701
Uniprot ID: Q8TER5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SQLQDSGDPPLVQRLLILIHDDLPTELCGFQGAEVLSENDLKRVAKPEELQWELGGHRDPSPSHWVEIHQEVVRLCRLCQGVLGS
• Gene Sequence: SQLQDSGDPPLVQRLLILIHDDLPTELCGFQGAEVLSENDLKRVAKPEELQWELGGHRDPSPSHWVEIHQEVVRLCRLCQGVLGS
• Gene ID - Mouse: ENSMUSG00000004562
• Gene ID - Rat: ENSRNOG00000052354
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.