Anti ARHGEF35 pAb (ATL-HPA045699)

Atlas Antibodies

SKU: ATL-HPA045699-25

• 

Protein Description: Rho guanine nucleotide exchange factor (GEF) 35
Gene Name: ARHGEF35
Alternative Gene Name: ARHGEF5L, CTAGE4, FLJ43692
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033542: 48%, ENSRNOG00000005506: 55%
Entrez Gene ID: 445328
Uniprot ID: A5YM69
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HPQEVQVLEEQGQQEAGFRGEGTLREDVCADGLLGEEQMIEQVNDEKGEQKQKQEQVQDVMLGRQGERMGLTGEPEGLNDGEWE
• Gene Sequence: HPQEVQVLEEQGQQEAGFRGEGTLREDVCADGLLGEEQMIEQVNDEKGEQKQKQEQVQDVMLGRQGERMGLTGEPEGLNDGEWE
• Gene ID - Mouse: ENSMUSG00000033542
• Gene ID - Rat: ENSRNOG00000005506
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.