Anti ARHGEF33 pAb (ATL-HPA034661)

Atlas Antibodies

Catalog No.: ATL-HPA034661-25

Protein Description: Rho guanine nucleotide exchange factor (GEF) 33
Gene Name: ARHGEF33
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054901: 89%, ENSRNOG00000007061: 90%
Entrez Gene ID: 100271715
Uniprot ID: A8MVX0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CLSADIQSKGHLPSGMWRQPKDGKEWGEEYVTKDHPDKLKEAGQGRHSSLENVLCETSLAAKRQTVALELLE
• Gene Sequence: CLSADIQSKGHLPSGMWRQPKDGKEWGEEYVTKDHPDKLKEAGQGRHSSLENVLCETSLAAKRQTVALELLE
• Gene ID - Mouse: ENSMUSG00000054901
• Gene ID - Rat: ENSRNOG00000007061
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.