Anti ARHGEF25 pAb (ATL-HPA052016 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA052016-25

Protein Description: Rho guanine nucleotide exchange factor (GEF) 25
Gene Name: ARHGEF25
Alternative Gene Name: GEFT, p63RhoGEF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019467: 83%, ENSRNOG00000005034: 83%
Entrez Gene ID: 115557
Uniprot ID: Q86VW2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HSKHCLSVETEADSGQAGPYENWMLEPALATGEELPELTLLTTLLEGPGDKTQPPEEETLSQAPESEEEQKKKALERSMYV
• Gene Sequence: HSKHCLSVETEADSGQAGPYENWMLEPALATGEELPELTLLTTLLEGPGDKTQPPEEETLSQAPESEEEQKKKALERSMYV
• Gene ID - Mouse: ENSMUSG00000019467
• Gene ID - Rat: ENSRNOG00000005034
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.