Anti ARHGDIG pAb (ATL-HPA078260)

Atlas Antibodies

Catalog No.: ATL-HPA078260-25

Protein Description: Rho GDP dissociation inhibitor gamma
Gene Name: ARHGDIG
Alternative Gene Name: RHOGDI-3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073433: 70%, ENSRNOG00000005809: 42%
Entrez Gene ID: 398
Uniprot ID: Q99819
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DKEGGPPAVDEVLDEAVPEYRAPGRKSLLEIRQLDPDDRSLAKYKRVLLGPLPPAVDPSLPNV
• Gene Sequence: DKEGGPPAVDEVLDEAVPEYRAPGRKSLLEIRQLDPDDRSLAKYKRVLLGPLPPAVDPSLPNV
• Gene ID - Mouse: ENSMUSG00000073433
• Gene ID - Rat: ENSRNOG00000005809
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.