Anti ARHGAP42 pAb (ATL-HPA039924)

Atlas Antibodies

Catalog No.: ATL-HPA039924-25

Protein Description: Rho GTPase activating protein 42
Gene Name: ARHGAP42
Alternative Gene Name: FLJ32810, GRAF3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050730: 96%, ENSRNOG00000026821: 97%
Entrez Gene ID: 143872
Uniprot ID: A6NI28
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DPSIPLPQPQSRSGSRRTRAICLSTGSRKPRGRYTPCLAEPDSDSYSSSPDSTPMGSIESLSSHSSEQNSTTKSASCQ
• Gene Sequence: DPSIPLPQPQSRSGSRRTRAICLSTGSRKPRGRYTPCLAEPDSDSYSSSPDSTPMGSIESLSSHSSEQNSTTKSASCQ
• Gene ID - Mouse: ENSMUSG00000050730
• Gene ID - Rat: ENSRNOG00000026821
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.