Anti ARFRP1 pAb (ATL-HPA047028 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA047028-100

• 
• 

Protein Description: ADP-ribosylation factor related protein 1
Gene Name: ARFRP1
Alternative Gene Name: ARL18, ARP, Arp1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038671: 99%, ENSRNOG00000013992: 99%
Entrez Gene ID: 10139
Uniprot ID: Q13795
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ANKQDVETCLSIPDIKTAFSDCTSKIGRRDCLTQACSALTGKGVREGIEWMVKCVVRNVHRPPRQRDIT
• Gene Sequence: ANKQDVETCLSIPDIKTAFSDCTSKIGRRDCLTQACSALTGKGVREGIEWMVKCVVRNVHRPPRQRDIT
• Gene ID - Mouse: ENSMUSG00000038671
• Gene ID - Rat: ENSRNOG00000013992
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.