Anti AQP6 pAb (ATL-HPA015278 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA015278-25

• 

Protein Description: aquaporin 6, kidney specific
Gene Name: AQP6
Alternative Gene Name: AQP2L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043144: 55%, ENSRNOG00000053181: 55%
Entrez Gene ID: 363
Uniprot ID: Q13520
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PDTKTLAQRLAILTGTVEVGTGAGAGAEPLKKESQPGSGAVEME
• Gene Sequence: PDTKTLAQRLAILTGTVEVGTGAGAGAEPLKKESQPGSGAVEME
• Gene ID - Mouse: ENSMUSG00000043144
• Gene ID - Rat: ENSRNOG00000053181
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.