Anti APOM pAb (ATL-HPA051006)

Atlas Antibodies

Catalog No.: ATL-HPA051006-100

Protein Description: apolipoprotein M
Gene Name: APOM
Alternative Gene Name: ApoM, G3a, NG20
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024391: 80%, ENSRNOG00000000850: 81%
Entrez Gene ID: 55937
Uniprot ID: O95445
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LNSIYQCPEHSQLTTLGVDGKEFPEVHLGQWYFIAGAAPTKEELATFDPVDNIVFNMAAGSAPMQLHLRATIRMK
• Gene Sequence: LNSIYQCPEHSQLTTLGVDGKEFPEVHLGQWYFIAGAAPTKEELATFDPVDNIVFNMAAGSAPMQLHLRATIRMK
• Gene ID - Mouse: ENSMUSG00000024391
• Gene ID - Rat: ENSRNOG00000000850
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.