Anti APOBEC3G pAb (ATL-HPA001812 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA001812-25

• 

Protein Description: apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3G
Gene Name: APOBEC3G
Alternative Gene Name: bK150C2.7, CEM15, dJ494G10.1, FLJ12740, MDS019
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040627: 39%, ENSRNOG00000015478: 39%
Entrez Gene ID: 60489
Uniprot ID: Q9HC16
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MHNDTWVLLNQRRGFLCNQAPHKHGFLEGRHAELCFLDVIPFWKLDLDQDYRVTCFTSWSPCFSCAQEMAKFISKNKHVSLCIFTARIYDDQGRCQEGLRTLAEAGAKISIMTYSEFKHCWDTFVDHQGCPFQPWDGLDEHSQDLSGRL
• Gene Sequence: MHNDTWVLLNQRRGFLCNQAPHKHGFLEGRHAELCFLDVIPFWKLDLDQDYRVTCFTSWSPCFSCAQEMAKFISKNKHVSLCIFTARIYDDQGRCQEGLRTLAEAGAKISIMTYSEFKHCWDTFVDHQGCPFQPWDGLDEHSQDLSGRL
• Gene ID - Mouse: ENSMUSG00000040627
• Gene ID - Rat: ENSRNOG00000015478
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti APOBEC3G pAb (ATL-HPA001812 w/enhanced validation) – 5 Found

Leonard, Brandon; Starrett, Gabriel J; Maurer, Matthew J; Oberg, Ann L; Van Bockstal, Mieke; Van Dorpe, Jo; De Wever, Olivier; Helleman, Jozien; Sieuwerts, Anieta M; Berns, Els M J J; Martens, John W M; Anderson, Brett D; Brown, William L; Kalli, Kimberly R; Kaufmann, Scott H; Harris, Reuben S. APOBEC3G Expression Correlates with T-Cell Infiltration and Improved Clinical Outcomes in High-grade Serous Ovarian Carcinoma. Clinical Cancer Research : An Official Journal Of The American Association For Cancer Research. 2016;22(18):4746-55. 

Hansen, Scott G; Piatak, Michael Jr; Ventura, Abigail B; Hughes, Colette M; Gilbride, Roxanne M; Ford, Julia C; Oswald, Kelli; Shoemaker, Rebecca; Li, Yuan; Lewis, Matthew S; Gilliam, Awbrey N; Xu, Guangwu; Whizin, Nathan; Burwitz, Benjamin J; Planer, Shannon L; Turner, John M; Legasse, Alfred W; Axthelm, Michael K; Nelson, Jay A; Früh, Klaus; Sacha, Jonah B; Estes, Jacob D; Keele, Brandon F; Edlefsen, Paul T; Lifson, Jeffrey D; Picker, Louis J. Immune clearance of highly pathogenic SIV infection. Nature. 2013;502(7469):100-4. 

Sandler, Netanya G; Bosinger, Steven E; Estes, Jacob D; Zhu, Richard T R; Tharp, Gregory K; Boritz, Eli; Levin, Doron; Wijeyesinghe, Sathi; Makamdop, Krystelle Nganou; del Prete, Gregory Q; Hill, Brenna J; Timmer, J Katherina; Reiss, Emma; Yarden, Ganit; Darko, Samuel; Contijoch, Eduardo; Todd, John Paul; Silvestri, Guido; Nason, Martha; Norgren, Robert B Jr; Keele, Brandon F; Rao, Srinivas; Langer, Jerome A; Lifson, Jeffrey D; Schreiber, Gideon; Douek, Daniel C. Type I interferon responses in rhesus macaques prevent SIV infection and slow disease progression. Nature. 2014;511(7511):601-5. 

Deleage, Claire; Immonen, Taina T; Fennessey, Christine M; Reynaldi, Arnold; Reid, Carolyn; Newman, Laura; Lipkey, Leslie; Schlub, Timothy E; Camus, Celine; O'Brien, Sean; Smedley, Jeremy; Conway, Jessica M; Del Prete, Gregory Q; Davenport, Miles P; Lifson, Jeffrey D; Estes, Jacob D; Keele, Brandon F. Defining early SIV replication and dissemination dynamics following vaginal transmission. Science Advances. 2019;5(5):eaav7116. 

Peng, Ting; Liu, Binghan; Lin, Shitong; Cao, Canhui; Wu, Ping; Zhi, Wenhua; Wei, Ye; Chu, Tian; Gui, Lingli; Ding, Wencheng. APOBEC3G expression correlates with unfavorable prognosis and immune infiltration in kidney renal clear cell carcinoma. Heliyon. 2022;8(12):e12191.