Anti APIP pAb (ATL-HPA024131 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA024131-100

• 
• 

Protein Description: APAF1 interacting protein
Gene Name: APIP
Alternative Gene Name: APIP2, CGI-29, Mmrp19
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000010911: 96%, ENSRNOG00000007446: 92%
Entrez Gene ID: 51074
Uniprot ID: Q96GX9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NTPEEKDLKDRMAHAMNEYPDSCAVLVRRHGVYVWGETWEKAKTMCECYDYLFDIAVSMKKVGLDPSQLPVGENGIV
• Gene Sequence: NTPEEKDLKDRMAHAMNEYPDSCAVLVRRHGVYVWGETWEKAKTMCECYDYLFDIAVSMKKVGLDPSQLPVGENGIV
• Gene ID - Mouse: ENSMUSG00000010911
• Gene ID - Rat: ENSRNOG00000007446
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.