Anti AP4E1 pAb (ATL-HPA041891)

Atlas Antibodies

SKU: ATL-HPA041891-25

• 

Protein Description: adaptor-related protein complex 4, epsilon 1 subunit
Gene Name: AP4E1
Alternative Gene Name: AP-4-EPSILON, SPG51
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001998: 95%, ENSRNOG00000022938: 95%
Entrez Gene ID: 23431
Uniprot ID: Q9UPM8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AELNHNVTYAILFECVHTVYSIYPKSELLEKAAKCIGKFVLSPKINLKYLGLKALTYVIQQDPTLALQHQMTIIECLDHPDPIIKRETLELLYRITNAQNITV
• Gene Sequence: AELNHNVTYAILFECVHTVYSIYPKSELLEKAAKCIGKFVLSPKINLKYLGLKALTYVIQQDPTLALQHQMTIIECLDHPDPIIKRETLELLYRITNAQNITV
• Gene ID - Mouse: ENSMUSG00000001998
• Gene ID - Rat: ENSRNOG00000022938
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.