Anti AP3B2 pAb (ATL-HPA039467 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA039467-25

Protein Description: adaptor-related protein complex 3, beta 2 subunit
Gene Name: AP3B2
Alternative Gene Name: NAPTB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062444: 95%, ENSRNOG00000019249: 93%
Entrez Gene ID: 8120
Uniprot ID: Q13367
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: APVFMSENEFKKEQGKLMGMNEITEKLMLPDTCRSDHIVVQKVTATANLGRVPCGTSDEYRFAGRTLTGGSLVLLTLDARPAGAAQLTVNSEKMVIGTMLVKDVIQ
• Gene Sequence: APVFMSENEFKKEQGKLMGMNEITEKLMLPDTCRSDHIVVQKVTATANLGRVPCGTSDEYRFAGRTLTGGSLVLLTLDARPAGAAQLTVNSEKMVIGTMLVKDVIQ
• Gene ID - Mouse: ENSMUSG00000062444
• Gene ID - Rat: ENSRNOG00000019249
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.