Anti AOX1 pAb (ATL-HPA040199 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA040199-25

• 

Protein Description: aldehyde oxidase 1
Gene Name: AOX1
Alternative Gene Name: AO, AOH1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063558: 84%, ENSRNOG00000015354: 86%
Entrez Gene ID: 316
Uniprot ID: Q06278
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MYHALLKHLGTLAGSQIRNMASLGGHIISRHPDSDLNPILAVGNCTLNLLSKEGKRQIPLNEQFLSKCPNADLKPQEILVSVNIPYSRKWE
• Gene Sequence: MYHALLKHLGTLAGSQIRNMASLGGHIISRHPDSDLNPILAVGNCTLNLLSKEGKRQIPLNEQFLSKCPNADLKPQEILVSVNIPYSRKWE
• Gene ID - Mouse: ENSMUSG00000063558
• Gene ID - Rat: ENSRNOG00000015354
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.