Anti ANXA9 pAb (ATL-HPA028698 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA028698-25

Protein Description: annexin A9
Gene Name: ANXA9
Alternative Gene Name: ANX31
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015702: 71%, ENSRNOG00000021134: 71%
Entrez Gene ID: 8416
Uniprot ID: O76027
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SYSGIIDYNLAEQDVQALQRAEGPSREETWVPVFTQRNPEHLIRVFDQYQRSTGQELEEAVQNRFHGDAQVAL
• Gene Sequence: SYSGIIDYNLAEQDVQALQRAEGPSREETWVPVFTQRNPEHLIRVFDQYQRSTGQELEEAVQNRFHGDAQVAL
• Gene ID - Mouse: ENSMUSG00000015702
• Gene ID - Rat: ENSRNOG00000021134
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.