Anti ANLN pAb (ATL-HPA050556 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA050556-25

Protein Description: anillin, actin binding protein
Gene Name: ANLN
Alternative Gene Name: ANILLIN, scra, Scraps
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036777: 86%, ENSRNOG00000014343: 85%
Entrez Gene ID: 54443
Uniprot ID: Q9NQW6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DLFSDVLEEGELDMEKSQEEMDQALAESSEEQEDALNISSMSLLAPLAQTVGVVSPESLVSTPRLELKDTSRSDESPKPGKFQRTRVPRAESGDSLGSEDRDLLYSIDAYRSQRFKETERPSIKQVIVRKEDV
• Gene Sequence: DLFSDVLEEGELDMEKSQEEMDQALAESSEEQEDALNISSMSLLAPLAQTVGVVSPESLVSTPRLELKDTSRSDESPKPGKFQRTRVPRAESGDSLGSEDRDLLYSIDAYRSQRFKETERPSIKQVIVRKEDV
• Gene ID - Mouse: ENSMUSG00000036777
• Gene ID - Rat: ENSRNOG00000014343
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.