Anti ANKRD65 pAb (ATL-HPA065720 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA065720-25

Protein Description: ankyrin repeat domain 65
Gene Name: ANKRD65
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078487: 57%, ENSRNOG00000043331: 51%
Entrez Gene ID: 441869
Uniprot ID: E5RJM6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EEEQELRWMELDSEEALGTRTEGPSVVQGWGHLLQAVWRGPAGLVTQLLRQGH
• Gene Sequence: EEEQELRWMELDSEEALGTRTEGPSVVQGWGHLLQAVWRGPAGLVTQLLRQGH
• Gene ID - Mouse: ENSMUSG00000078487
• Gene ID - Rat: ENSRNOG00000043331
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.