Anti ANKRD33 pAb (ATL-HPA040013)

Atlas Antibodies

SKU: ATL-HPA040013-25

• 

Protein Description: ankyrin repeat domain 33
Gene Name: ANKRD33
Alternative Gene Name: C12orf7, DKFZp686O1689, PANKY
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047034: 59%, ENSRNOG00000049733: 60%
Entrez Gene ID: 341405
Uniprot ID: Q7Z3H0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SKSVPELLGTAPPPPLVPQSPPGSPQRSPWVFVPYQSPQGILSKCLQWLQPRDSTSPRPQVPKILLSKASSSSHQCQPKPSPSGHQSLALPLW
• Gene Sequence: SKSVPELLGTAPPPPLVPQSPPGSPQRSPWVFVPYQSPQGILSKCLQWLQPRDSTSPRPQVPKILLSKASSSSHQCQPKPSPSGHQSLALPLW
• Gene ID - Mouse: ENSMUSG00000047034
• Gene ID - Rat: ENSRNOG00000049733
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.