Anti ANGEL2 pAb (ATL-HPA030795)

Atlas Antibodies

Catalog No.: ATL-HPA030795-25

Protein Description: angel homolog 2
Gene Name: ANGEL2
Alternative Gene Name: Ccr4d, FLJ12793, KIAA0759L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026634: 85%, ENSRNOG00000003795: 84%
Entrez Gene ID: 90806
Uniprot ID: Q5VTE6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EGDEPSSKRRKHQGVIKRNWEYICSHDKEKTKILGDKNVDPKCEDSENKFDFSVMSYNILSQDLLEDNSHLYRHCRRPVLHWSFRFPNILKEIK
• Gene Sequence: EGDEPSSKRRKHQGVIKRNWEYICSHDKEKTKILGDKNVDPKCEDSENKFDFSVMSYNILSQDLLEDNSHLYRHCRRPVLHWSFRFPNILKEIK
• Gene ID - Mouse: ENSMUSG00000026634
• Gene ID - Rat: ENSRNOG00000003795
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.