Anti AMZ2 pAb (ATL-HPA023299 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA023299-25

Protein Description: archaelysin family metallopeptidase 2
Gene Name: AMZ2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020610: 82%, ENSRNOG00000000246: 80%
Entrez Gene ID: 51321
Uniprot ID: Q86W34
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AGEQRLMNEAFQPASDLFGPITLHSPSDWITSHPEAPQDFEQFFSDPYRKTPSPNKRSIYIQSIGSLGNTRIIS
• Gene Sequence: AGEQRLMNEAFQPASDLFGPITLHSPSDWITSHPEAPQDFEQFFSDPYRKTPSPNKRSIYIQSIGSLGNTRIIS
• Gene ID - Mouse: ENSMUSG00000020610
• Gene ID - Rat: ENSRNOG00000000246
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.