Anti AMPD1 pAb (ATL-HPA028080 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA028080-25

• 
• 

Protein Description: adenosine monophosphate deaminase 1
Gene Name: AMPD1
Alternative Gene Name: MAD, MADA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070385: 81%, ENSRNOG00000018656: 81%
Entrez Gene ID: 270
Uniprot ID: P23109
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AEEKQIDDAMRNFAEKVFASEVKDEGGRQEISPFDVDEICPISHHEMQAHIFHLETLSTSTEARRKKRFQGRKTVNLSIPL
• Gene Sequence: AEEKQIDDAMRNFAEKVFASEVKDEGGRQEISPFDVDEICPISHHEMQAHIFHLETLSTSTEARRKKRFQGRKTVNLSIPL
• Gene ID - Mouse: ENSMUSG00000070385
• Gene ID - Rat: ENSRNOG00000018656
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.