Anti AMDHD1 pAb (ATL-HPA039720)

Atlas Antibodies

Catalog No.: ATL-HPA039720-25

Protein Description: amidohydrolase domain containing 1
Gene Name: AMDHD1
Alternative Gene Name: MGC35366
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015890: 84%, ENSRNOG00000005266: 83%
Entrez Gene ID: 144193
Uniprot ID: Q96NU7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AHSVPKGKTATEAADDIINNHLPKLKELGRNGEIHVDNIDVFCEKGVFDLDSTRRILQRGKDIGLQINFHGDELHPM
• Gene Sequence: AHSVPKGKTATEAADDIINNHLPKLKELGRNGEIHVDNIDVFCEKGVFDLDSTRRILQRGKDIGLQINFHGDELHPM
• Gene ID - Mouse: ENSMUSG00000015890
• Gene ID - Rat: ENSRNOG00000005266
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.