Anti ALDH6A1 pAb (ATL-HPA029073 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA029073-25

Protein Description: aldehyde dehydrogenase 6 family, member A1
Gene Name: ALDH6A1
Alternative Gene Name: MMSDH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021238: 95%, ENSRNOG00000011419: 97%
Entrez Gene ID: 4329
Uniprot ID: Q02252
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RCMALSTAVLVGEAKKWLPELVEHAKNLRVNAGDQPGADLGPLITPQAKERVCNLIDSGTKEGASILLDGRKIKVKGYENGNFVGPTIISNVKPNM
• Gene Sequence: RCMALSTAVLVGEAKKWLPELVEHAKNLRVNAGDQPGADLGPLITPQAKERVCNLIDSGTKEGASILLDGRKIKVKGYENGNFVGPTIISNVKPNM
• Gene ID - Mouse: ENSMUSG00000021238
• Gene ID - Rat: ENSRNOG00000011419
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ALDH6A1 pAb (ATL-HPA029073 w/enhanced validation) – 1 Found

Lu, Jun; Chen, Zhan; Zhao, Hu; Dong, Huiyue; Zhu, Ling; Zhang, Yi; Wang, Jie; Zhu, Hehuan; Cui, Qiang; Qi, Chuang; Wang, Shuiliang; Chen, Shushang; Shao, Jichun. ABAT and ALDH6A1, regulated by transcription factor HNF4A, suppress tumorigenic capability in clear cell renal cell carcinoma. Journal Of Translational Medicine. 2020;18(1):101.