Anti ALDH6A1 pAb (ATL-HPA029072 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA029072-25

• 
• 

Protein Description: aldehyde dehydrogenase 6 family, member A1
Gene Name: ALDH6A1
Alternative Gene Name: MMSDH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021238: 96%, ENSRNOG00000011419: 95%
Entrez Gene ID: 4329
Uniprot ID: Q02252
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SCKRAFPAWADTSVLSRQQVLLRYQQLIKENLKEIAKLITLEQGKTLADAEGDVFRGLQVVEHACSVTSLMMGETMPSIT
• Gene Sequence: SCKRAFPAWADTSVLSRQQVLLRYQQLIKENLKEIAKLITLEQGKTLADAEGDVFRGLQVVEHACSVTSLMMGETMPSIT
• Gene ID - Mouse: ENSMUSG00000021238
• Gene ID - Rat: ENSRNOG00000011419
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.