Anti ALDH1B1 pAb (ATL-HPA021037 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA021037-25

• 
• 
• 

Protein Description: aldehyde dehydrogenase 1 family, member B1
Gene Name: ALDH1B1
Alternative Gene Name: ALDH5, ALDHX
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035561: 79%, ENSRNOG00000011497: 82%
Entrez Gene ID: 219
Uniprot ID: P30837
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MLRFLAPRLLSLQGRTARYSSAAALPSPILNPDIPYNQLFINNEWQDAVSKKTFPTVNPTTGEVIGHV
• Gene Sequence: MLRFLAPRLLSLQGRTARYSSAAALPSPILNPDIPYNQLFINNEWQDAVSKKTFPTVNPTTGEVIGHV
• Gene ID - Mouse: ENSMUSG00000035561
• Gene ID - Rat: ENSRNOG00000011497
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.