Anti AKR1B1 pAb (ATL-HPA052751 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA052751-100

Protein Description: aldo-keto reductase family 1, member B1 (aldose reductase)
Gene Name: AKR1B1
Alternative Gene Name: ALDR1, AR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001642: 83%, ENSRNOG00000009513: 85%
Entrez Gene ID: 231
Uniprot ID: P15121
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDY
• Gene Sequence: VTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDY
• Gene ID - Mouse: ENSMUSG00000001642
• Gene ID - Rat: ENSRNOG00000009513
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.