Anti AKR1A1 pAb (ATL-HPA027734)

Atlas Antibodies

SKU: ATL-HPA027734-25

• 
• 

Protein Description: aldo-keto reductase family 1, member A1 (aldehyde reductase)
Gene Name: AKR1A1
Alternative Gene Name: ALR, DD3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028692: 95%, ENSRNOG00000016727: 96%
Entrez Gene ID: 10327
Uniprot ID: P14550
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PDEPVLLEEPVVLALAEKYGRSPAQILLRWQVQRKVICIPKSITPSRILQNIKVFDFTFSPEEMKQLNALNKNWRYIVPMLTVDGKRVPRDAGHPLYPF
• Gene Sequence: PDEPVLLEEPVVLALAEKYGRSPAQILLRWQVQRKVICIPKSITPSRILQNIKVFDFTFSPEEMKQLNALNKNWRYIVPMLTVDGKRVPRDAGHPLYPF
• Gene ID - Mouse: ENSMUSG00000028692
• Gene ID - Rat: ENSRNOG00000016727
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.