Anti AK9 pAb (ATL-HPA031779)

Atlas Antibodies

SKU: ATL-HPA031779-25

• 

Protein Description: adenylate kinase 9
Gene Name: AK9
Alternative Gene Name: AKD1, AKD2, C6orf199, C6orf224, dJ70A9.1, FLJ25791, FLJ42177, MGC26954
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000091415: 81%, ENSRNOG00000037688: 81%
Entrez Gene ID: 221264
Uniprot ID: Q5TCS8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YCPVTYKDGNQRYEALVPGSINYALEYHNRIYICENKEKLQKFLRSPLKYWEQKLPHKLPPLREPILLTSLPLPGYLEQGIATSLIKAMNA
• Gene Sequence: YCPVTYKDGNQRYEALVPGSINYALEYHNRIYICENKEKLQKFLRSPLKYWEQKLPHKLPPLREPILLTSLPLPGYLEQGIATSLIKAMNA
• Gene ID - Mouse: ENSMUSG00000091415
• Gene ID - Rat: ENSRNOG00000037688
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.