Anti AK4 pAb (ATL-HPA049461 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA049461-25

Protein Description: adenylate kinase 4
Gene Name: AK4
Alternative Gene Name: AK3, AK3L1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028527: 94%, ENSRNOG00000045738: 90%
Entrez Gene ID: 205
Uniprot ID: P27144
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PEAVAARLRQYKDVAKPVIELYKSRGVLHQF
• Gene Sequence: PEAVAARLRQYKDVAKPVIELYKSRGVLHQF
• Gene ID - Mouse: ENSMUSG00000028527
• Gene ID - Rat: ENSRNOG00000045738
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.