Anti AIFM2 pAb (ATL-HPA042309 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA042309-25

• 
• 

Protein Description: apoptosis-inducing factor, mitochondrion-associated, 2
Gene Name: AIFM2
Alternative Gene Name: AMID, FLJ14497, PRG3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020085: 86%, ENSRNOG00000059445: 86%
Entrez Gene ID: 84883
Uniprot ID: Q9BRQ8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NLVILCTGIKINSSAYRKAFESRLASSGALRVNEHLQVEGHSNVYAIGDCADVRTPKMAYLAGLHANIAVANIVNSVKQRPLQAYKPGALTFLLSMGRNDGVGQISGFYVGRLMVRLTKSRDLFVSTSWKTM
• Gene Sequence: NLVILCTGIKINSSAYRKAFESRLASSGALRVNEHLQVEGHSNVYAIGDCADVRTPKMAYLAGLHANIAVANIVNSVKQRPLQAYKPGALTFLLSMGRNDGVGQISGFYVGRLMVRLTKSRDLFVSTSWKTM
• Gene ID - Mouse: ENSMUSG00000020085
• Gene ID - Rat: ENSRNOG00000059445
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.