Anti AHSP pAb (ATL-HPA040940 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA040940-25

Protein Description: alpha hemoglobin stabilizing protein
Gene Name: AHSP
Alternative Gene Name: EDRF, ERAF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042644: 28%, ENSRNOG00000020165: 66%
Entrez Gene ID: 51327
Uniprot ID: Q9NZD4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ALLKANKDLISAGLKEFSVLLNQQVFNDPLVSEEDMVTVVEDWMNFYINYYRQQVTGEPQERDKALQELRQELNTLANPFLAKYRDFLKSH
• Gene Sequence: ALLKANKDLISAGLKEFSVLLNQQVFNDPLVSEEDMVTVVEDWMNFYINYYRQQVTGEPQERDKALQELRQELNTLANPFLAKYRDFLKSH
• Gene ID - Mouse: ENSMUSG00000042644
• Gene ID - Rat: ENSRNOG00000020165
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.