Anti AHNAK2 pAb (ATL-HPA000878 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA000878-25

Protein Description: AHNAK nucleoprotein 2
Gene Name: AHNAK2
Alternative Gene Name: C14orf78
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000072812: 36%, ENSRNOG00000028545: 31%
Entrez Gene ID: 113146
Uniprot ID: Q8IVF2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TKYSQESWFKMPKFRMPSLRRSFRDRGGAGKLEVAQTQAPAATGGEAAAKVKEFLVSGSNVEAAMSLQLPEADAEVTASESKSSTDILRCDLDSTGLKLHLSTAGMTGDELSTSEVRIHPSKGPLPFQMPGMRLPETQVLPGEIDETP
• Gene Sequence: TKYSQESWFKMPKFRMPSLRRSFRDRGGAGKLEVAQTQAPAATGGEAAAKVKEFLVSGSNVEAAMSLQLPEADAEVTASESKSSTDILRCDLDSTGLKLHLSTAGMTGDELSTSEVRIHPSKGPLPFQMPGMRLPETQVLPGEIDETP
• Gene ID - Mouse: ENSMUSG00000072812
• Gene ID - Rat: ENSRNOG00000028545
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti AHNAK2 pAb (ATL-HPA000878 w/enhanced validation) – 2 Found

Wang, Minglei; Li, Xuefeng; Zhang, Jin; Yang, Qiong; Chen, Wenqi; Jin, Weilin; Huang, Yi-Ran; Yang, Ru; Gao, Wei-Qiang. AHNAK2 is a Novel Prognostic Marker and Oncogenic Protein for Clear Cell Renal Cell Carcinoma. Theranostics. 7(5):1100-1113. 

Xie, Zhenyu; Lun, Yu; Li, Xin; He, Yuzhen; Wu, Song; Wang, Shiyue; Sun, Jianjian; He, Yuchen; Zhang, Jian. Bioinformatics analysis of the clinical value and potential mechanisms of AHNAK2 in papillary thyroid carcinoma. Aging. 2020;12(18):18163-18180.