Anti AGXT pAb (ATL-HPA035370 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA035370-25

Protein Description: alanine-glyoxylate aminotransferase
Gene Name: AGXT
Alternative Gene Name: AGT, AGT1, AGXT1, PH1, SPAT, SPT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026272: 86%, ENSRNOG00000023856: 90%
Entrez Gene ID: 189
Uniprot ID: P21549
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HPMTKDPGGHYTLQEVEEGLAQHKPVLLFLTHGESSTGVLQPLDGFGELCHRYKCLLLVDSVASLGGTPLYMDRQGIDILYSGS
• Gene Sequence: HPMTKDPGGHYTLQEVEEGLAQHKPVLLFLTHGESSTGVLQPLDGFGELCHRYKCLLLVDSVASLGGTPLYMDRQGIDILYSGS
• Gene ID - Mouse: ENSMUSG00000026272
• Gene ID - Rat: ENSRNOG00000023856
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti AGXT pAb (ATL-HPA035370 w/enhanced validation) – 1 Found

Castello, R; Borzone, R; D'Aria, S; Annunziata, P; Piccolo, P; Brunetti-Pierri, N. Helper-dependent adenoviral vectors for liver-directed gene therapy of primary hyperoxaluria type 1. Gene Therapy. 2016;23(2):129-34.