Anti AGMAT pAb (ATL-HPA026443 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA026443-25

Protein Description: agmatine ureohydrolase (agmatinase)
Gene Name: AGMAT
Alternative Gene Name: FLJ23384
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040706: 79%, ENSRNOG00000012315: 80%
Entrez Gene ID: 79814
Uniprot ID: Q9BSE5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MLGTVNPSTGALPFQSLMVADLGDVNVNLYNLQDSCRRIQEAYEKIVAAGCIPLTLGGDHTITYPILQAMAKKHGPVGLLHVDAHTDTTDKALGEKLYHG
• Gene Sequence: MLGTVNPSTGALPFQSLMVADLGDVNVNLYNLQDSCRRIQEAYEKIVAAGCIPLTLGGDHTITYPILQAMAKKHGPVGLLHVDAHTDTTDKALGEKLYHG
• Gene ID - Mouse: ENSMUSG00000040706
• Gene ID - Rat: ENSRNOG00000012315
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.