Anti ADPRHL1 pAb (ATL-HPA066478 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA066478-100

Protein Description: ADP-ribosylhydrolase like 1
Gene Name: ADPRHL1
Alternative Gene Name: ARH2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031448: 83%, ENSRNOG00000062013: 83%
Entrez Gene ID: 113622
Uniprot ID: Q8NDY3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ALFVSFAAQGKPLVQWGRDMLRAVPLAEEYCRKTIRHTAEYQEHWFYFEAKWQFYLEERKISKDSENKAIFPDNYDAEEREKTYRKWSSEGR
• Gene Sequence: ALFVSFAAQGKPLVQWGRDMLRAVPLAEEYCRKTIRHTAEYQEHWFYFEAKWQFYLEERKISKDSENKAIFPDNYDAEEREKTYRKWSSEGR
• Gene ID - Mouse: ENSMUSG00000031448
• Gene ID - Rat: ENSRNOG00000062013
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.