Anti ADD3 pAb (ATL-HPA035696 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA035696-25

• 
• 
• 

Protein Description: adducin 3 (gamma)
Gene Name: ADD3
Alternative Gene Name: ADDL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025026: 84%, ENSRNOG00000012820: 83%
Entrez Gene ID: 120
Uniprot ID: Q9UEY8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ASSVSQIQSQTQSPQNVPEKLEENHELFSKSFISMEVPVMVVNGKDDMHDVEDELAKRVSRLSTSTTIENIEITIKSPEKIEEVLSPE
• Gene Sequence: ASSVSQIQSQTQSPQNVPEKLEENHELFSKSFISMEVPVMVVNGKDDMHDVEDELAKRVSRLSTSTTIENIEITIKSPEKIEEVLSPE
• Gene ID - Mouse: ENSMUSG00000025026
• Gene ID - Rat: ENSRNOG00000012820
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ADD3 pAb (ATL-HPA035696 w/enhanced validation) – 1 Found

Kiang, Karrie Mei-Yee; Sun, Stella; Leung, Gilberto Ka-Kit. ADD3 Deletion in Glioblastoma Predicts Disease Status and Survival. Frontiers In Oncology. 11( 34970477):717793.