Anti ADCY10 pAb (ATL-HPA015243)

Atlas Antibodies

SKU: ATL-HPA015243-25

• 

Protein Description: adenylate cyclase 10 (soluble)
Gene Name: ADCY10
Alternative Gene Name: HCA2, RP1-313L4.2, SAC, SACI, Sacy
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026567: 80%, ENSRNOG00000053410: 80%
Entrez Gene ID: 55811
Uniprot ID: Q96PN6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NLENLVAQNTTGPVFCPRLYHLMAYVCILMGDGQKCGLFLNTALRLSETQGNILEKCWLNMNKESWYSTSELKEDQWLQTILSLPSW
• Gene Sequence: NLENLVAQNTTGPVFCPRLYHLMAYVCILMGDGQKCGLFLNTALRLSETQGNILEKCWLNMNKESWYSTSELKEDQWLQTILSLPSW
• Gene ID - Mouse: ENSMUSG00000026567
• Gene ID - Rat: ENSRNOG00000053410
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.