Anti ADAP1 pAb (ATL-HPA012049 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA012049-25

• 

Protein Description: ArfGAP with dual PH domains 1
Gene Name: ADAP1
Alternative Gene Name: CENTA1, GCS1L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056413: 90%, ENSRNOG00000054033: 89%
Entrez Gene ID: 11033
Uniprot ID: O75689
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LGVFICLSCSGIHRNIPQVSKVKSVRLDAWEEAQVEFMASHGNDAARARFESKVPSFYYRPTPSDCQLLREQWIRAKYERQEFIYPEKQEPYSAGYREGFLWKRG
• Gene Sequence: LGVFICLSCSGIHRNIPQVSKVKSVRLDAWEEAQVEFMASHGNDAARARFESKVPSFYYRPTPSDCQLLREQWIRAKYERQEFIYPEKQEPYSAGYREGFLWKRG
• Gene ID - Mouse: ENSMUSG00000056413
• Gene ID - Rat: ENSRNOG00000054033
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ADAP1 pAb (ATL-HPA012049 w/enhanced validation) – 1 Found

Giguère, Hugo; Dumont, Audrey-Ann; Berthiaume, Jonathan; Oliveira, Vanessa; Laberge, Gino; Auger-Messier, Mannix. ADAP1 limits neonatal cardiomyocyte hypertrophy by reducing integrin cell surface expression. Scientific Reports. 2018;8(1):13605.